Protein Info for Atu3572 in Agrobacterium fabrum C58

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF13560: HTH_31" amino acids 13 to 67 (55 residues), 37.9 bits, see alignment E=2.7e-13 PF01381: HTH_3" amino acids 17 to 69 (53 residues), 49.9 bits, see alignment E=4.1e-17 PF13443: HTH_26" amino acids 19 to 71 (53 residues), 30.6 bits, see alignment E=4.8e-11

Best Hits

Swiss-Prot: 54% identical to Y045_SINMW: Uncharacterized HTH-type transcriptional regulator Smed_0045 (Smed_0045) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3572)

Predicted SEED Role

"DNA-binding protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFE4 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Atu3572 transcriptional regulator (Agrobacterium fabrum C58)
MQAKLPSPIDVHVGTQIRMRRKSLGMSQSALAGRLGITFQQVQKYEKGANRVGASRLQAI
ASILGVEVSSLFANATPDGGAANPALGTINAMQTFVASNEGFSLNQAFSRIKSVAVRRSI
VALVTSLAASETAENAGTPTDKSDD