Protein Info for Atu3534 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 105 (38 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 330 (268 residues), 117.1 bits, see alignment E=4.1e-38

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu3534)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFC5 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Atu3534 ABC transporter permease (Agrobacterium fabrum C58)
MTVNDSLLTKGVQDAEERMGSSLSQGRFFLTNEFGLILLIVVFAVSFGVAAGGFLSPFNL
FTLGRSAAINIMIGLSMMAVIVTGGLNLAVGAIGVSAAMACGYLIEVLGVPWPLALIGGL
ATGAALGFINGWTVIRTGLHSFIITLATMSIFFGVMIFLTRAEAYRGLPPIFAAFGKMKL
ATYFSPLLLVTLVTALALSFLYRRTVLGREMLASGARPEAAELSGIRVDRIFIACHVLSG
LLAALAALMLVTRTGAAIPSMAGQLGQDWLLPAFLGPVLGGTLLQGGKVSVLGTCLGALL
VTMLTSGLLLLQLGEFWVQTFLGLLLLLAVLMDKARGSYLARRNLA