Protein Info for Atu3531 in Agrobacterium fabrum C58

Annotation: 3-oxoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 6 to 196 (191 residues), 167.3 bits, see alignment E=7.5e-53 PF08659: KR" amino acids 7 to 158 (152 residues), 54.1 bits, see alignment E=4.7e-18 PF01370: Epimerase" amino acids 8 to 169 (162 residues), 31.9 bits, see alignment E=2.4e-11 PF13561: adh_short_C2" amino acids 12 to 243 (232 residues), 182.2 bits, see alignment E=3.1e-57 PF13460: NAD_binding_10" amino acids 12 to 140 (129 residues), 34 bits, see alignment E=7e-12

Best Hits

Swiss-Prot: 38% identical to FABG_VIBCH: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to atu:Atu3531)

MetaCyc: 30% identical to putative 2-keto-3-deoxy-D-gluconate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]; 1.1.1.- [EC: 1.1.1.127]; RXN0-7101 [EC: 1.1.1.127]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.127

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFC3 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Atu3531 3-oxoacyl-ACP reductase (Agrobacterium fabrum C58)
MELKHKTALVTGACGGIGRAVVAALVAQGARVIAFDRDIEAVTALAKGFGSACDPVAVDL
GDAAALQAVMRDIAGRFKVIDILVNNAGVLSPHKLAATTLEEWHRLMAVNLDAALLLTQA
VVPAMKENRWGRLINISSYAWKSGGLTAGTAYSVSKSALVGLTYSSARELASFGITANAV
APAYVVSPMIMEQLSEEDRQRQLAAIPVGRFCQPEEVAHAVRFLASPLSGFMTGTVVDMN
GGLQFG