Protein Info for Atu3529 in Agrobacterium fabrum C58

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF03786: UxuA" amino acids 1 to 387 (387 residues), 363.8 bits, see alignment E=7.9e-113 TIGR00695: mannonate dehydratase" amino acids 1 to 390 (390 residues), 464.2 bits, see alignment E=1.9e-143 PF01261: AP_endonuc_2" amino acids 211 to 329 (119 residues), 32.3 bits, see alignment E=8.4e-12

Best Hits

Swiss-Prot: 100% identical to UXUA2_AGRFC: Mannonate dehydratase 2 (uxuA2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 100% identity to atu:Atu3529)

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.8

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UA46 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Atu3529 mannonate dehydratase (Agrobacterium fabrum C58)
MKETWRWFGESDPITLEHVRQTGASGVVTALHQIPDGTAWPAEEIAKRKAMIEAAGLEWS
VCESIPMEQSIKRGDADAPKAIARWKDTLSRLGRAGVPVVCYNFMPVVDWTRTNLRWQAR
NTGLALRFEMADFVAYDVFILKRIRAAENYDPALVARAEERFAQMSEDEQSLLERNIIAG
LPGGALVQTRQSIAALIASFDGIDSATMQGNLLAFLKEVVPVAEEVGVHLGIHPDDPPFS
LFGLPRVVSTPADIRAILSAVESPNNGITLCTGSYGARSDNDLVAMAKEFASRVNFAHLR
NVTVEADGSFFEDDHLDGGADMIGVIEALLREERSTAKAGRRTNIPMRPDHGHLLGDDIT
KKTNPGYSYIGRMKGLGELRGVIRTIERQLRREEAAA