Protein Info for Atu3522 in Agrobacterium fabrum C58

Annotation: glucans biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 227 to 243 (17 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 10 to 363 (354 residues), 121.8 bits, see alignment E=1.7e-39

Best Hits

KEGG orthology group: K11941, glucans biosynthesis protein C [EC: 2.1.-.-] (inferred from 100% identity to atu:Atu3522)

Predicted SEED Role

"Glucans biosynthesis protein C (EC 2.1.-.-)" (EC 2.1.-.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSP1 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Atu3522 glucans biosynthesis protein (Agrobacterium fabrum C58)
MQPGKSDYEHYWDPLRALLMMLGIPYHASLLYSHVLPWDIKDFETSPLLSGLGAALVTFR
MPTFFLVAGYFSTMVIGKKGKMRWLRQRFLRLGVPFIVAVVLLGPLQLFLLQLASVAKGD
IPTDRLLESLPGLLRPSEQWIMHLWFLPALIAYSVLLAALLFLAAHPPFTHVRNWFNSLQ
QRHATLVFAALCTLPVLWELMVYGSGLLAASSGSRLFLLYERASDPYARYLPFFLLGALL
QRNRALFHQFRQTGFPTVVIAAGAIGAAVALRLQHPFSTSALLVLVSAIAAVAASRLLID
LACRYFDRPSPLARRMTDASFTIYLFHHPLIYTFGILFILIALPPILEFAIIVAATTATA
YMLHQAIRRSPLALFLFNGVRRPRGVDDIGTQAGASQTLR