Protein Info for Atu3519 in Agrobacterium fabrum C58

Annotation: peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13145: Rotamase_2" amino acids 116 to 239 (124 residues), 68.8 bits, see alignment E=1.1e-22 PF13616: Rotamase_3" amino acids 134 to 227 (94 residues), 83.4 bits, see alignment E=2.8e-27 PF00639: Rotamase" amino acids 146 to 225 (80 residues), 80.5 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3519)

Predicted SEED Role

"Foldase protein PrsA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSN8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Atu3519 peptidyl-prolyl cis-trans isomerase (Agrobacterium fabrum C58)
MLRYNKIAAAVIVATLGLQLPAFAQEDKVVAKVGDLEIHQSELDLAMGNLDPQLAQLPDE
QKKVAALSGAIDVKLLVKNADAEGLEKTEDFKKRMEFIKDRELHNAYFRKHVVDAVTNDE
VKARYDKEVAALPQEEEIKAAHILVASEDEAKDIIKQLDSGKDFAALAKEKSTDSNKDDG
GDLGWFGKGRMVPEFEEAAFGLEKGAYTKTPVKTQFGFHVIKLEDKRIAPPPAFEQVEPQ
VRQLVMRDKYVALIEKAKADQKIEIMDETLKKGYDQATKEQQAQPPQQ