Protein Info for Atu3492 in Agrobacterium fabrum C58

Annotation: sugar kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00370: FGGY_N" amino acids 12 to 245 (234 residues), 62.5 bits, see alignment E=4.9e-21 PF21546: FGGY_C_2" amino acids 253 to 428 (176 residues), 230.3 bits, see alignment E=1.6e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3492)

MetaCyc: 62% identical to rhamnulokinase (Rhizobium leguminosarum bv. trifolii)
Rhamnulokinase. [EC: 2.7.1.5]

Predicted SEED Role

"Rhamnulokinase RhaK in alpha-proteobacteria (EC 2.7.1.5)" in subsystem L-rhamnose utilization (EC 2.7.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSL6 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Atu3492 sugar kinase (Agrobacterium fabrum C58)
MSNSINLGRVAVIDIGKTNAKVVVIDTGSGEEIAAEKRTNPVLRDGPYPHYDVEMLWNFI
LAALQRFGHEPGFDAISITTHGASAALLDGTGDLAMPVLDYEHIYAEPVQQAYRGIRPDF
AETGSPQLPAGLNLGAQIHFQKTNFPDDFARVRSIVTYPQYWAGRLTGVQATETTSLGCH
TDLWNPRRKSFSSLVGRLGIEHLMAPVRSAFDVLGTIRPSLAQETGLSPDMPVYCGIHDS
NASLLPHLLRREGDFSVVSTGTWVVNFAIGGKADALDPARDTLLNVDALGRPVPSSRFMG
GREYEMLAQQFGAATPHDIEAALGGVIEKGMMLLPSVVSGSGPFPQSASRWIADSDATGA
ERHAAASLYLALMTEFCLSLVERRGPIVVEGPFAGNALYLKALAAFAATDVIAMEGSTGT
SAGAALLTGIKPVAGRERHFTAEDIAGLTSYRTAWQNHLT