Protein Info for Atu3491 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05336: rhaM
  • amino acids 6 to 106 (101 residues), 99.7 bits, E=5.3e-33
• TIGR02625: L-rhamnose mutarotase
  • amino acids 7 to 106 (100 residues), 107.1 bits, E=2.5e-35

Best Hits

Swiss-Prot: 100% identical to RHAM_AGRFC: L-rhamnose mutarotase (rhaM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 100% identity to atu:Atu3491)

MetaCyc: 77% identical to L-rhamnose mutarotase monomer (Rhizobium leguminosarum bv. trifolii)
RXN0-5306 [EC: 5.1.3.32]

Predicted SEED Role

"L-rhamnose mutarotase" in subsystem L-rhamnose utilization

MetaCyc Pathways

• L-rhamnose degradation I (4/5 steps found)
• superpathway of fucose and rhamnose degradation (7/12 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-

Use Curated BLAST to search for 5.1.3.- or 5.1.3.32

Sequence Analysis Tools

See A9CFA8 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Atu3491 hypothetical protein (Agrobacterium fabrum C58)
MPELEKHAFRMKLFAGKEVEYKKRHDEIWPELVALLHEAGVSDYSIHLDPETSILFGVLT
RPKVHGMAALPEHPVMKKWWAHMADIMESNPDNSPVAKDLVTVFHLP