Protein Info for Atu3490 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 68 to 95 (28 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 268 to 296 (29 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 67 to 321 (255 residues), 132.1 bits, see alignment E=1.1e-42

Best Hits

KEGG orthology group: K10561, rhamnose transport system permease protein (inferred from 100% identity to atu:Atu3490)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 1" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSL4 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu3490 ABC transporter permease (Agrobacterium fabrum C58)
MSTNSQPSQAPRVIPDKLGTPLSRIMASWEVLLLGVAILIFIANSLASPYFLNAWNLSDA
TFNFTEKAIIAFAMALLIIAGEIDLSVAAIIALASTAMGAAVQMGVGTPGLVAIGIGTGL
FCGAFNGFLVAGLKLPSIVVTIGTMSLFRGISYMVLGDQAYGKYPADFAYFGQGYVFWVI
SFEFVLFIVMAVLFAILLHATNFGRQVYVIGTNPFAARFSGIPVERVKFILFLLTGLMSG
IAAVCLTSRLGSTRPSIAQGWELEVVTMVVLGGVSILGGSGTIAGVVIAAFVMGLVTFGL
GLLNVPGIVMSIFVGLLLIITIAIPIVVRRLRAMRG