Protein Info for Atu3489 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 10 to 27 (18 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 249 to 277 (29 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 304 (270 residues), 132.4 bits, see alignment E=9e-43

Best Hits

KEGG orthology group: K10560, rhamnose transport system permease protein (inferred from 100% identity to atu:Atu3489)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 2" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFA7 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Atu3489 ABC transporter permease (Agrobacterium fabrum C58)
MQRLLKNREWLLAGIIIIMIAGFALRAPGFGRPGNLVNIFNDTSILIILALGQMAVILTK
SIDLSVAANLAFTGMAVAMTNAAFPGVPLPLLIVMAVGIGAFLGSLNGILVWWLGIPPIV
VTLGTLTIYRGMAFVLSGGGWVNAHQFSPTFLNVPRTMILGMPVLSWVAILIIAGAWLVL
TRTSFGRSAYASGGNPGAAVYAGIDVGRTRFFAFVLSGALAGLASYLWVSRYAVAYVDIA
AGFELDSVAANVIGGISIAGGIGSVAGAVLGALFLGVIKNALPVIGISPFAQMAISGVVI
VLAVVFNARAEARKGRIILRDRAAADHGKEASA