Protein Info for Atu3487 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 33 to 240 (208 residues), 31.1 bits, see alignment E=1.7e-11 TIGR02637: rhamnose ABC transporter, rhamnose-binding protein" amino acids 34 to 334 (301 residues), 521.1 bits, see alignment E=4.2e-161 PF13407: Peripla_BP_4" amino acids 34 to 291 (258 residues), 227.2 bits, see alignment E=2.7e-71

Best Hits

Swiss-Prot: 35% identical to LSRB_YERE8: Autoinducer 2-binding protein LsrB (lsrB) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K10559, rhamnose transport system substrate-binding protein (inferred from 100% identity to atu:Atu3487)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, substrate-binding component" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFA6 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu3487 sugar ABC transporter substrate-binding protein (Agrobacterium fabrum C58)
MKLTRRTLTSVLALSAALSVAGLGSIAEAADVKIALVVKSLGNGFFEAANKGAQEAAKDL
GGVEIIYTGPTSTTAEGQIEVINSLIAQGVDAIAISANDPDAVVPALKKAAQRGIKVISW
DSGVAPEGRILQLNPSSNALIGKMCLQLAAAHLEGGKGDFAILSATTTSTNQNVWIGEMK
KQLKDFPGLNLVTTVYGDDLADKSYREAQGLLSSQPNVKVIVAPTTVGVLAASQAVKDAG
KIGQVFVTGLGLPSEMAGAIKSGATKEFAIWNPIDLGYSATQIAYRLVKGEADGKPGSEI
EAGRMGKIKVGENSEAAMADPFIYDAKNIDQFSKIF