Protein Info for Atu3486 in Agrobacterium fabrum C58

Annotation: DeoR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF08220: HTH_DeoR" amino acids 6 to 60 (55 residues), 50.4 bits, see alignment E=2.2e-17 PF08279: HTH_11" amino acids 15 to 47 (33 residues), 22 bits, see alignment 1.8e-08 PF00455: DeoRC" amino acids 79 to 234 (156 residues), 152 bits, see alignment E=2e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3486)

Predicted SEED Role

"Transcriptional regulator of rhamnose utilization, DeoR family" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFA5 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Atu3486 DeoR family transcriptional regulator (Agrobacterium fabrum C58)
MHERERHRIILSATQEKAVVTVQDIAELTDASEATIRRDIASLHVQGKLRRVRGGAEAVH
PPQLGNLAARPFRVSESVNIDKKRAIARKAVDLCNDGDAIILNGGTTTFQMVHYMAARRL
QVMTNSFAIAEHLVKHSKCNVNVPGGAIYRDQSLILSPFENDAIRNFYARRIFLGAQGVG
ALGIMESDALVIQSEQKLMRQAEELIVMVDSSKFRKRSSLILCPLENVTTIITDDGISDE
AARMVENAGVELLIAGAVAAGKTAGPPDEENSSSVA