Protein Info for Atu3483 in Agrobacterium fabrum C58

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02548: Pantoate_transf" amino acids 10 to 264 (255 residues), 347.8 bits, see alignment E=1.9e-108 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 10 to 270 (261 residues), 305.3 bits, see alignment E=2e-95

Best Hits

Swiss-Prot: 100% identical to PANB_AGRFC: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 100% identity to atu:Atu3483)

MetaCyc: 44% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Thermococcus kodakarensis)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UA91 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Atu3483 3-methyl-2-oxobutanoate hydroxymethyltransferase (Agrobacterium fabrum C58)
MSAHAKQKRLTTASIRQMKGEARIVCLTAYTTPIARLLDPHCDLLLVGDSLGMVLYGMET
TVGVTLDMMIAHGRAVMRGVEHACVIVDLPFGTYQESKEQAFRNAVRLMQETGCDGVKLE
GGEEMAETIAFLVARGIPVFGHVGLMPQLVHTAGGFRSLGHSDAETQKIWRDGIAVDQAG
AFAIVVEGTVEPLARELTEKLAAPTVGIGASPACDGQVLVSDDMLGLFSDFKPKFVKRYA
DLGTAATQAAAAYADEVRSGAFPGPEHTFQVRKPSPSGK