Protein Info for Atu3477 in Agrobacterium fabrum C58

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF02771: Acyl-CoA_dh_N" amino acids 16 to 126 (111 residues), 140.9 bits, see alignment E=4.5e-45 PF02770: Acyl-CoA_dh_M" amino acids 131 to 225 (95 residues), 84.6 bits, see alignment E=8.7e-28 PF00441: Acyl-CoA_dh_1" amino acids 237 to 385 (149 residues), 147.3 bits, see alignment E=8e-47 PF08028: Acyl-CoA_dh_2" amino acids 253 to 368 (116 residues), 55.6 bits, see alignment E=1.4e-18

Best Hits

Swiss-Prot: 69% identical to IVD_SOLTU: Isovaleryl-CoA dehydrogenase, mitochondrial (IVD) from Solanum tuberosum

KEGG orthology group: K00253, isovaleryl-CoA dehydrogenase [EC: 1.3.99.10] (inferred from 100% identity to atu:Atu3477)

MetaCyc: 68% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.4 or 1.3.99.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFA3 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Atu3477 acyl-CoA dehydrogenase (Agrobacterium fabrum C58)
MSLNLAAIFDADLGPEIAALRDSASAFADDKIAPLATEIDRNDRFPRQLWPQMGELGLHG
ITVSEEFGGADMGYLAHCVAMEEISRASASIGLSYGAHSNLCINQIHRWGTDEQKHRYLP
KLVSGDHVGSLAMSETEAGSDVVSMRLKAERKGDRYVLNGAKMWITNGHEADTLVVYAKT
DMSAGARGITAFLIEKGFKGFRPAQKLDKLGMRGSPTSELVFEDCEVPEENILGRLNDGV
TVLMSGLDYERAVLAAGPVGIMQAAIDLVLPYVRERKQFGKAIGEFQLVQGKLADIYSAM
NASRAYVYAVARACDNGRITRQDAAGAILFAAERATQVALDAIQLLGGSGYVNESPAGRL
LRDAKLYEIGAGTSEIRRMLIGRELVKGNG