Protein Info for Atu3468 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 91 to 107 (17 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details PF20398: DUF6691" amino acids 9 to 138 (130 residues), 141.7 bits, see alignment E=1e-45

Best Hits

Swiss-Prot: 60% identical to Y765_XYLFA: UPF0394 membrane protein XF_0765 (XF_0765) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K07112, (no description) (inferred from 100% identity to atu:Atu3468)

Predicted SEED Role

"GENE II AND X PROTEINS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSJ5 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Atu3468 hypothetical protein (Agrobacterium fabrum C58)
MKNPAAARLALALIAGALFGFGLSLSGMIDPARVSGFLDVASSHWDPSLIFVLGGAVVVA
VPGVLLSRLLVRPILAEDFSLPTKTRIDRPLILGSTIFGLGWGLAGFCPGPALSAFALGL
APVILFVCAMIAGMFVHDRFYAKEP