Protein Info for Atu3465 in Agrobacterium fabrum C58

Annotation: metallo-beta-lactamase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF04273: BLH_phosphatase" amino acids 6 to 110 (105 residues), 82.6 bits, see alignment E=2.6e-27 TIGR01244: TIGR01244 family protein" amino acids 6 to 132 (127 residues), 96.2 bits, see alignment E=8.3e-32 PF00753: Lactamase_B" amino acids 160 to 345 (186 residues), 65.6 bits, see alignment E=6e-22

Best Hits

Swiss-Prot: 100% identical to BLH_AGRFC: Beta-lactamase hydrolase-like protein (blh) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3465)

Predicted SEED Role

"SoxH protein, homolog" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UAA9 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Atu3465 metallo-beta-lactamase superfamily protein (Agrobacterium fabrum C58)
MKAVRINERLTIAGQPMIADFPSLSAQGFKSIINARPDGEEPGQPGNTQEKSAAGAAGMD
YGFIPVSGPTITEADIRAFQQKMAEAEGPVFAHCKGGTRALTLYVLGEALDGRIQRSDIE
DFGKTHGFDLCAATRWLERQSAAVPHIKAFFDPRTWSVQYVVSDPATGGCAIIDPVYDFD
EKSGATGTMNADAILDYVKRHGLSVEWILDTHPHADHFSAADYLKQKTGAKTAIGAKVTG
VQKLWQEKYNWSDFKTDGSQWDQLFEAGDRFSIGSLEARVLFSPGHTLASVTYVVGNAAF
VHDTLFMPDSGTARADFPGGSAKQLWASIQDILALPDDTRLFTGHDYQPGGRAPKWESTV
GEQTRSNPHLAGMTEEDFVRLREARDRTLPMPKLILHALQVNIRGGRLPEPEANGKHYLK
FPLDVLEGSTW