Protein Info for Atu3444 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF00496: SBP_bac_5" amino acids 92 to 454 (363 residues), 300.4 bits, see alignment E=1.1e-93

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to atu:Atu3444)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF80 at UniProt or InterPro

Protein Sequence (543 amino acids)

>Atu3444 oligopeptide ABC transporter substrate-binding protein (Agrobacterium fabrum C58)
MPENLITSLQEETSMDITRRKTLLLSAALAGAMLLPSMPALATETPKKGGIVTLAGLGEP
TTLVPLSDSNTRTRAISTKILEGLVRFDSEFKPHPVLAESWETSADGLRYTFKLRKGVKW
HDGKDFTAQDVKFSLLAFKKVGPRGRITFANLADIETPNPLTAVVVLSKPAPYLLRALTG
GETPILPAHAYASENYNESPNGNAPVGTGPFVFEEWKRGSYVKLKKNPDYWQADLPYLDG
FVARFVADAASTTISVETGEADYTADVSYSDLERLRQNPKLAVEVYTDAYLNNAAIFEFN
LENAILAKKEVRHALAHAIDRNFINDAIFFGTAKPAGSNIPAVFSTYNDEKPFTYPFDLA
KANELLDKAGYPKGADGTRFSLRLAFLPSDVFRKTSEYLRSSFGKLGVKVDIVEGDLATF
IKRVYTERGFDLTVNGISRLFDPTAGVQRLYWSDGIKNPAPYVNAAHYNNPTVDDLFRAA
AIEVDETKRAGQFHEIQKVVGDDLPNFSIVALPTVILRNTSLKSLVTTIDIAYGDLSTAW
KSE