Protein Info for Atu3418 in Agrobacterium fabrum C58

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF00583: Acetyltransf_1" amino acids 43 to 137 (95 residues), 54.7 bits, see alignment E=1.9e-18 PF13673: Acetyltransf_10" amino acids 55 to 156 (102 residues), 31.3 bits, see alignment E=2.9e-11 PF13508: Acetyltransf_7" amino acids 55 to 138 (84 residues), 42.6 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3418)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF67 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Atu3418 acetyltransferase (Agrobacterium fabrum C58)
MSDSFFYTSVKDPLATPLLEELLFEYDSRYGTFFNAEGARAELNKYPPEAFSPPSGNFLL
LLRDGKPIAGGAFMRHDDETAEFKRVWTHSAHRRQGLAKIVLRELEEQAVRQGYARVYLT
TGFRQPEAVGLYLTNGYRALFDTAADPETIRSLPFEKWLSNTVLDGAPIPVAQPQSSPVH
P