Protein Info for Atu3395 in Agrobacterium fabrum C58

Annotation: iron (III ABC transporter permease ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 204 to 250 (47 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details PF01032: FecCD" amino acids 5 to 310 (306 residues), 283.4 bits, see alignment E=2.1e-88 PF00950: ABC-3" amino acids 92 to 285 (194 residues), 24.6 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 37% identical to BTUC_ESCF3: Vitamin B12 import system permease protein BtuC (btuC) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu3395)

MetaCyc: 31% identical to ferric enterobactin ABC transporter membrane subunit FepG (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Copper ABC transporter, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF52 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu3395 iron (III ABC transporter permease ABC transporter permease (Agrobacterium fabrum C58)
MAGAAIGETAIPFDVVAKTIANRVFHAGYPLEPLDEGIVWSYRLSRAVVAACCGASLALA
GAVLQSLLRNPLADPYILGISAGASTGAVAVALLGFGAGFLTMPAGALIGAFVAFSLVSL
LAVRAGHGNSAIILAGVAGSQLFNAMTSFIVTKSANAEQARGIMFWLLGNLSGVRWPDVW
LALPVSLAGLAVCLWYARALDAFAFGGQAAASLGIPVRWVYAVLISVSAIMTAAMVSLVG
SIGFVGLVIPHAARIFVGVRHGILLPVTALTGAVFMIIADILSRIVIPGQVLPIGVITAL
VGAPAFAFILGQKRGRS