Protein Info for Atu3392 in Agrobacterium fabrum C58

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF05175: MTS" amino acids 35 to 162 (128 residues), 36.8 bits, see alignment E=1.1e-12 PF01209: Ubie_methyltran" amino acids 36 to 159 (124 residues), 61.9 bits, see alignment E=2e-20 PF13489: Methyltransf_23" amino acids 42 to 159 (118 residues), 45.5 bits, see alignment E=2.5e-15 PF13847: Methyltransf_31" amino acids 58 to 164 (107 residues), 67 bits, see alignment E=5.8e-22 PF08242: Methyltransf_12" amino acids 62 to 155 (94 residues), 45.2 bits, see alignment E=4.6e-15 PF13649: Methyltransf_25" amino acids 62 to 153 (92 residues), 72.8 bits, see alignment E=1.1e-23 PF08241: Methyltransf_11" amino acids 62 to 157 (96 residues), 78.3 bits, see alignment E=2e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3392)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF50 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu3392 methyltransferase (Agrobacterium fabrum C58)
MIDTMQYGKNDSLRDEIKAYWSGRAATFDLSPGHEIFSEDERAAWHALILKHLGRGEGRK
ALDLASGTGVISHLMDDLGFQVTGMDWSETMLGLAREKAKSRGRNIRFFVGDAENTMEPD
ESADVIITRHLVWTLVDPQASFAEWFRVLKPGGKLLIVDGDFVNTGWRERLVKKLAVSLE
SIGLVKADQPHKPADPENTFNSILSRVYFSKGARAGDVATMLGATGFEPVSVDQELRAIH
RAQAKNFSLLKGILRGLQHRYAVCAVKPDTSVKG