Protein Info for Atu3392 in Agrobacterium fabrum C58

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 35 to 162 (128 residues), 33.8 bits, E=9.2e-12
• PF01209: Ubie_methyltran
  • amino acids 36 to 159 (124 residues), 61.9 bits, E=2e-20
• PF13489: Methyltransf_23
  • amino acids 43 to 159 (117 residues), 45.9 bits, E=1.8e-15
• PF13847: Methyltransf_31
  • amino acids 58 to 167 (110 residues), 67 bits, E=5.9e-22
• PF08241: Methyltransf_11
  • amino acids 62 to 157 (96 residues), 78.3 bits, E=2e-25
• PF13649: Methyltransf_25
  • amino acids 62 to 153 (92 residues), 73.1 bits, E=8.5e-24
• PF08242: Methyltransf_12
  • amino acids 62 to 155 (94 residues), 45.2 bits, E=4.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3392)

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.64

Sequence Analysis Tools

See A9CF50 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu3392 methyltransferase (Agrobacterium fabrum C58)
MIDTMQYGKNDSLRDEIKAYWSGRAATFDLSPGHEIFSEDERAAWHALILKHLGRGEGRK
ALDLASGTGVISHLMDDLGFQVTGMDWSETMLGLAREKAKSRGRNIRFFVGDAENTMEPD
ESADVIITRHLVWTLVDPQASFAEWFRVLKPGGKLLIVDGDFVNTGWRERLVKKLAVSLE
SIGLVKADQPHKPADPENTFNSILSRVYFSKGARAGDVATMLGATGFEPVSVDQELRAIH
RAQAKNFSLLKGILRGLQHRYAVCAVKPDTSVKG