Protein Info for Atu3389 in Agrobacterium fabrum C58

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 190 to 192 (3 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details PF01032: FecCD" amino acids 35 to 347 (313 residues), 270 bits, see alignment E=1.2e-84

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu3389)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF47 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Atu3389 iron ABC transporter permease (Agrobacterium fabrum C58)
MTSLNESADGVSGRDQYRALAARRILILVGLFLALCFSMAADMALGPARYTLSEVLATIA
DPAAVGNQLRVVIWDIRMPIALMAVTVGASLSVAGAQMQTILSNPLASPFTLGISAAASF
GAALALVGGVAIFPGAVHYMVPINAFIMAMIAALFIHFASTMRGVTVETIVLLGIALVFT
FNAALSLLEYLASEQALAAVVFWTMGSLTKATWDKVYITAAILVVTVPLFMRQAWALTAL
RLGDDKAASMGINVRRLRLTTMLTVSLLAAIPVSFVGTIGFVGLVGPHIARMVVGEDQRF
FLPGSIICGALLLSATSVISKILIPGAILPIGVITALVGVPFFFALIFGNRRRAW