Protein Info for Atu3379 in Agrobacterium fabrum C58

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 130 to 157 (28 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 76 (76 residues), 54.1 bits, see alignment E=1.7e-18 PF00528: BPD_transp_1" amino acids 113 to 311 (199 residues), 127.8 bits, see alignment E=4.2e-41

Best Hits

Swiss-Prot: 41% identical to Y1092_BRUSU: Putative peptide transport system permease protein BRA1092/BS1330_II1084 (BRA1092) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3379)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF40 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Atu3379 peptide ABC transporter permease (Agrobacterium fabrum C58)
MIRFILSRLLMALPTIAFVSITVFALIRFIPGDPAALMLGDMAQPEQIEAMRTELGLDKS
MLQQFVIWAGNVVQGDFGRSIVNDEAVLPLVVSRFLVSAEIVVVAVLLASLIAVPAGVIA
AWKQNSLTDLALVGTATLLLSIPTFWLGLLLLLFFGLKLGWLPVLGYVSISDNLVGGMLY
LVLPVMTLVIHEMGVLIRMARASTLEVLRLDYITHARAKGLSESAVLWRHAFKNAFGPTW
TMIGLILGNLLGGIAVIETVFTIPGLGRLMVDSIFARDYPVIQGCLLFVSLSYVLVNLFV
DLLYPLFDPRVVAE