Protein Info for Atu3371 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 PF00005: ABC_tran" amino acids 39 to 189 (151 residues), 115.8 bits, see alignment E=2.5e-37 amino acids 289 to 443 (155 residues), 77.8 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 100% identical to RGMG2_AGRFC: Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 (Atu3371) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to atu:Atu3371)

MetaCyc: 47% identical to ribose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UAK2 at UniProt or InterPro

Protein Sequence (513 amino acids)

>Atu3371 sugar ABC transporter ATPase (Agrobacterium fabrum C58)
MVVSPSTMAAVRASGAVPNAEFLLAADGIRKEFPGVVALDDVQFHLKRGTVHALMGENGA
GKSTLMKILAGIYQPDNGEIRLKGAPIRLDSPLDALENGIAMIHQELNLMAYMTVAENIW
IRREPKNRLGFIDHGEMYRRTETLLERLGIDLDPETRVGELSVASRQMVEIAKAVSYNSD
VLIMDEPTSALTEREVEHLFRIIRDLRERGIGIVYITHKMNELFEIADEFSVFRDGKYIG
THASTDVTRDDIIRMMVGREITQMFPKEEVPIGDVVLSVKNLNLDGVFHDVSFDVRAGEI
LGVAGLVGSGRSNVAETVFGVTPASSGTISIDGKPVSIDSPTTAISHRMAFLTEDRKDTG
CLLILNILENMQIAVLQDKYVANGFVQENALSEACEEMCRKLRVKTPHLYERIENLSGGN
QQKVLIGRWMLTKPRILILDEPTRGIDVGAKAEIHKLVCEMARQGVAVIMISSEMPEVLG
MSDRVMVMHEGRVTGFLARSEATQVKVMDLASR