Protein Info for Atu3366 in Agrobacterium fabrum C58

Annotation: tripartite ATP-independent periplasmic transporter DctQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details PF04290: DctQ" amino acids 30 to 161 (132 residues), 76.8 bits, see alignment E=7.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3366)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF31 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Atu3366 tripartite ATP-independent periplasmic transporter DctQ (Agrobacterium fabrum C58)
MKSLLKLSALIDLVSEALGKVAGYLVLICCLVSAGNAMVRYALNYSSNGWLEIQWYMFAF
IVLIGASYTLRMNEHVRVDIIYGAISPRSRLWVDIIGIVLFLIPACFYLAWLSWPMFTLS
WHQGEMSSNAGGLIRWPVKLVIFAGFALLVLQGFSELIKRVGALNGLYALDTKYEKPLQ