Protein Info for Atu3359 in Agrobacterium fabrum C58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 46 to 149 (104 residues), 67.3 bits, see alignment E=7e-23 PF00528: BPD_transp_1" amino acids 67 to 257 (191 residues), 62.8 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu3359)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF26 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Atu3359 amino acid ABC transporter permease (Agrobacterium fabrum C58)
MSAVVSQTRVAKKLPFGTILLLGVVISVVLWLILDPSLGQVLLQWLPYLAKGFAMNVLIS
ILAIAIGTFIGVVLGIMELAPYRIVRAPALTYVQIFRNAPHLVLIFAATYIFPFEIVAFG
NYIPFPDWIKAVVGLAIPASAHIAEITRGAIQSIPTAQWEAAQGLGFSRNQTLRWIILPQ
CVKRSLPPWMNLYSSITMGTALASLVGVHELLHAATDASTAVQRNDFTVVVYLTVLMAFF
LFCYPVSRFTQRLERRFASR