Protein Info for Atu3346 in Agrobacterium fabrum C58

Annotation: succinoglycan biosynthesis regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF06508: QueC" amino acids 2 to 208 (207 residues), 192.4 bits, see alignment E=7.5e-61 TIGR00364: queuosine biosynthesis protein QueC" amino acids 4 to 202 (199 residues), 181.9 bits, see alignment E=5.5e-58 PF00733: Asn_synthase" amino acids 8 to 62 (55 residues), 27.9 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 100% identical to QUEC_AGRFC: 7-cyano-7-deazaguanine synthase (queC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 100% identity to atu:Atu3346)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UAM7 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Atu3346 succinoglycan biosynthesis regulator (Agrobacterium fabrum C58)
MKTIVICSGGLDSVSLAHKIAAEHELLALVSFDYGQRHKKELDFAADCAKRLGVPHHLID
IGTIGAHLTGSALTDDIDVPDGHYAEETMRSTVVPNRNAIMLTIAFGLAAAQQADAVAIA
VHGGDHFIYPDCRPGFIGSFNAMQAHALEGYADVTLFAPYVTVSKAAIVTDAVKYGTPFG
ETWSCYKGGLRHCGRCGTCVERREAFHLAGVTDPTEYEDPDFWVAATQAYAAQEVH