Protein Info for Atu3341 in Agrobacterium fabrum C58

Annotation: trehalose/maltose ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 122.9 bits, see alignment E=2.2e-39 PF08402: TOBE_2" amino acids 256 to 326 (71 residues), 53 bits, see alignment E=4.5e-18 PF03459: TOBE" amino acids 267 to 324 (58 residues), 27.1 bits, see alignment E=5.9e-10

Best Hits

Swiss-Prot: 59% identical to SMOK_RHOSH: ATP-binding transport protein SmoK (smoK) from Rhodobacter sphaeroides

KEGG orthology group: K10239, trehalose/maltose transport system ATP-binding protein (inferred from 100% identity to atu:Atu3341)

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.19

Use Curated BLAST to search for 3.6.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF13 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu3341 trehalose/maltose ABC transporter ATPase (Agrobacterium fabrum C58)
MTTIQLRDLRKSFGAFDVIKGIDMDIRSGEFMVFVGPSGCGKSTLLRLICGLEEITGGTL
SFDGETVNRLPPAKRGVAMVFQSYALYPHMTVFENMAFGMKLSGADKEQRRKRVEAAAEM
LQLTPYLERLPKQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEIAKLH
REMHDTTMIYVTHDQVEAMTLADRICVLRDGRVEQIGTPLELYESPVNTFVAGFIGSPKM
NFLAGKYAEAEGAATIGIRPEHITVTTGENGWSGEIVHSEMLGSDSFIYVEIGAGEPIVV
REEGVTDRKAGERITLVADAAQIHRFDAQGQALARNPVRGAA