Protein Info for Atu3340 in Agrobacterium fabrum C58

Annotation: trehalose/maltose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 267 (180 residues), 54.4 bits, see alignment E=6.7e-19

Best Hits

Swiss-Prot: 38% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K10238, trehalose/maltose transport system permease protein (inferred from 100% identity to atu:Atu3340)

MetaCyc: 38% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS75 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Atu3340 trehalose/maltose ABC transporter permease (Agrobacterium fabrum C58)
MTLPGILKTTAFYALVAIIMVISVFPFYYAILTSLKSGSALFQVNYWPRDFSLTNYSFVI
GNGTFLRNLGNSLLVASSVVVLSLFLAVTASYALARVRFRGRSLLLLTILSVSMFPQIAV
LAGLFELIRWAGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGATPWV
IITQVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNEQRTVPVAIALLSGGSQFEIP
WGTIMAASVIVTAPLVVLVLIFQRRIISGLTAGGVKG