Protein Info for Atu3326 in Agrobacterium fabrum C58

Annotation: exopolysaccharide production protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02563: Poly_export" amino acids 31 to 118 (88 residues), 55.7 bits, see alignment E=4.7e-19 PF25994: HH_AprE" amino acids 171 to 355 (185 residues), 92.5 bits, see alignment E=3.9e-30

Best Hits

Swiss-Prot: 56% identical to EXOF_RHIME: Exopolysaccharide production protein ExoF (exoF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to atu:Atu3326)

Predicted SEED Role

"Exopolysaccharide production protein ExoF precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CF05 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Atu3326 exopolysaccharide production protein (Agrobacterium fabrum C58)
MNGLFAAHRPFVALVLTASVALAAPLSAMAAEGAQYKLGTADKLRIRVAEWQPADGSIRN
WDVINGDYSVGPSGTLSLPFIGQLEVAGKTPSEVSDQIGAQLQSKFALRNLPSASVEIAQ
FRPIFLSGDVQTPGEYPYAANLTVLKAVSLAGGLRRSDAGQRFARDFINARGDAAVYDNQ
RARLLARQARLIAEVKGDEAITKTPEMEKITEIDTLLASESALMKSRTDRYTLQLKALTD
LHALLESEVESLKKKSETQNRQLQLANEDRDRVNRLNEQGLALSQRRISAEERAAEVEST
LLDIDTQSLRAKQDINKATQDEINLRNDWVAQRSKELQDTEAELDKLNLQLTTSRELMSE
ALAQSAEAIRFDPSGKSATISYVVVRDENGKPKEQKVDENTLLQPGDVIKVSSEILMQ