Protein Info for Atu3314 in Agrobacterium fabrum C58

Annotation: cellulose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 431 to 454 (24 residues), see Phobius details amino acids 481 to 500 (20 residues), see Phobius details amino acids 509 to 529 (21 residues), see Phobius details amino acids 542 to 562 (21 residues), see Phobius details PF13506: Glyco_transf_21" amino acids 189 to 343 (155 residues), 38 bits, see alignment E=1.9e-13 PF13641: Glyco_tranf_2_3" amino acids 194 to 335 (142 residues), 35.6 bits, see alignment E=1.7e-12 PF13632: Glyco_trans_2_3" amino acids 200 to 411 (212 residues), 56.8 bits, see alignment E=5.5e-19 PF03552: Cellulose_synt" amino acids 269 to 414 (146 residues), 30.6 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3314)

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.12

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEZ9 at UniProt or InterPro

Protein Sequence (645 amino acids)

>Atu3314 cellulose synthase (Agrobacterium fabrum C58)
MKTHSTPSVPSARAIAATGDLRMQPVFRGWNRMAYRLGIGGWLVTLAWFWIWWLDRDRII
DWPYYTVVTITLAWITLLPSYFIFIFLNAKVVDPQSPLPRGRVAMVVTKAPSEPFAVVEK
TLLAMLEQKGLEFDVWLADEAPDAHTLKWCGAHGVFVSTRQGVADYHRKTWPRRTRCKEG
NLAYFYDHYGYERYDFVAQFDADHVPEPDYLREIIRPFADPAVGYVSAPSICDANADQSW
AARGRLYAEASLHGALQLGYNNGWAPLCIGSHYAVRTKALREVGGLGPELAEDHSTTLLM
NAGGWRGIHAVNAIAHGDGPVTFADLIVQEFQWSRSLMTILLQYSRHYVPKLPPRLKFQF
LFSQLWYPLFSGFMALMFVLPAVALVQGHVLVNASYPAFLMHFLPVSLIMIVFAFFWRAT
GAFRPHNAKLFSWEAMVFLFLRWPWSLMGVLAAIRDTVRGDFVDFRITPKGTQAKPPLPL
RVVAPYMVLAALSLLAMVLAPRENGAEGFFIFAAINVAIYAGLSVFLLIRHAMENGLPKL
PALRGGASAAACSLLLVAGSAAELSSHAIGGLEALSHGQPYVSFTETRFTVAGAGVEGAR
SIRLKLRIALPVLRGPQDMQAEPVVVPPPAVATGEILLADNRVGQ