Protein Info for Atu3297 in Agrobacterium fabrum C58

Annotation: two component sensor kinase for C4-dicarboxylate transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 160 to 178 (19 residues), see Phobius details PF00512: HisKA" amino acids 245 to 309 (65 residues), 33.8 bits, see alignment E=4.4e-12 PF02518: HATPase_c" amino acids 355 to 459 (105 residues), 86.8 bits, see alignment E=2e-28 PF14501: HATPase_c_5" amino acids 359 to 447 (89 residues), 30.5 bits, see alignment E=4.3e-11

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu3297)

Predicted SEED Role

"C4-dicarboxylate transport sensor protein dctB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS39 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Atu3297 two component sensor kinase for C4-dicarboxylate transport (Agrobacterium fabrum C58)
MSEHYALGNVSRRPGLYISRRIDASDGRPLGVVIAKVEFNRLESDWNIGGKPVYVVDRNG
VVLMTSVPEWRFKTVAPIDEARRKIIAESLQFGNETLATLPFRVARSSGDGVPLIHVDGP
ARARGDYLQLEVPVPTTSWTLHYLQPVAPALNVKIREGRVVALATLMPLMALSAFWLWRR
HKALREKEEEQRARAELEMKVQERTRDLTKTRDHLQAEITLHEKTTGELRNVQHELVQAN
RLSILGQVAAGVAHEINQPVATIRAFADNARTLLKRDRLAEANENLEDIAALTERIGTIT
TDLKILARKGRTAAEPVSARLVIEGAVVLLRSRFSGQMDALDIVLPDQDLKVLGSRIRLE
QILINLLQNALEATETIETARVEVRVREEGDMVVISVSDNGAGIPEAIRAQLFSPFNTSK
ESGLGLGLVISNDIASDYGGRIEVTSSGAGTSFSVYLKRA