Protein Info for Atu3289 in Agrobacterium fabrum C58

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 19 to 194 (176 residues), 188.6 bits, E=3.4e-60
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 29 to 205 (177 residues), 174.9 bits, E=5.7e-56

Best Hits

Swiss-Prot: 100% identical to THIE_AGRFC: Thiamine-phosphate synthase (thiE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to atu:Atu3289)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage IV (yeast) (5/7 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (1/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (1/2 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (5/8 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (5/10 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See Q8UAS8 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Atu3289 thiamine-phosphate pyrophosphorylase (Agrobacterium fabrum C58)
MNKVDYRLNALVDASLADVAPLPELALAAALNGATILQYRDKHGSTREMIENARAIREAI
GGTGVPLVINDRVDVALASGADGVHLGADDMDAKTARRILGEKAIIGLTVKNRADAERAA
SMPADYACIGGVFETVSKVNPDKPVGIEGFTTLRALLKEWQPDMPVGAIAGIDLDRVPAV
IAAGADGVAVISAIFRAANIASATSDFRSAIDAALKARQP