Protein Info for Atu3289 in Agrobacterium fabrum C58

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF02581: TMP-TENI" amino acids 19 to 194 (176 residues), 188.6 bits, see alignment E=3.4e-60 TIGR00693: thiamine-phosphate diphosphorylase" amino acids 29 to 205 (177 residues), 174.9 bits, see alignment E=5.7e-56

Best Hits

Swiss-Prot: 100% identical to THIE_AGRFC: Thiamine-phosphate synthase (thiE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to atu:Atu3289)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UAS8 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Atu3289 thiamine-phosphate pyrophosphorylase (Agrobacterium fabrum C58)
MNKVDYRLNALVDASLADVAPLPELALAAALNGATILQYRDKHGSTREMIENARAIREAI
GGTGVPLVINDRVDVALASGADGVHLGADDMDAKTARRILGEKAIIGLTVKNRADAERAA
SMPADYACIGGVFETVSKVNPDKPVGIEGFTTLRALLKEWQPDMPVGAIAGIDLDRVPAV
IAAGADGVAVISAIFRAANIASATSDFRSAIDAALKARQP