Protein Info for Atu3284 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 274 (180 residues), 67.9 bits, see alignment E=4.9e-23

Best Hits

Swiss-Prot: 40% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3284)

MetaCyc: 100% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS31 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Atu3284 sugar ABC transporter permease (Agrobacterium fabrum C58)
MSTVATSPGLSSFFSGKPLRFIAASILLVNGLFPAIWILFTSLKTEAELTVKPITWFPHA
PTLANYMQAFSDQPLHLFLFNSFMVALLSTALTILISVLAAYALARLNLKYRALILSLII
AVSTFPLVTLLVPLFEIMRALNLLNSWTALILPYTVLSLPVCTLMLVSFFESIPRDLENA
AMIDGCTRIGALFKVVVPLCAPGVFTAGILAFVNAWDEFLLALSFNSNPALRTLPVGIQL
YQGEFAFPWPVISAALVVGIVPVAILIVIFQERVVSGLTAGGLKG