Protein Info for Atu3284 in Agrobacterium fabrum C58
Annotation: sugar ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3284)MetaCyc: 100% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]
Predicted SEED Role
"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.5.2.M1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7CS31 at UniProt or InterPro
Protein Sequence (285 amino acids)
>Atu3284 sugar ABC transporter permease (Agrobacterium fabrum C58) MSTVATSPGLSSFFSGKPLRFIAASILLVNGLFPAIWILFTSLKTEAELTVKPITWFPHA PTLANYMQAFSDQPLHLFLFNSFMVALLSTALTILISVLAAYALARLNLKYRALILSLII AVSTFPLVTLLVPLFEIMRALNLLNSWTALILPYTVLSLPVCTLMLVSFFESIPRDLENA AMIDGCTRIGALFKVVVPLCAPGVFTAGILAFVNAWDEFLLALSFNSNPALRTLPVGIQL YQGEFAFPWPVISAALVVGIVPVAILIVIFQERVVSGLTAGGLKG