Protein Info for Atu3271 in Agrobacterium fabrum C58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF13439: Glyco_transf_4" amino acids 14 to 191 (178 residues), 42.8 bits, see alignment E=9.1e-15 PF00534: Glycos_transf_1" amino acids 197 to 339 (143 residues), 81.3 bits, see alignment E=9.8e-27 PF13692: Glyco_trans_1_4" amino acids 202 to 337 (136 residues), 70.1 bits, see alignment E=3.8e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3271)

MetaCyc: 54% identical to GDP-Man:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-mannosyltransferase (Salmonella enterica enterica serovar Newport)
RXN-21846 [EC: 2.4.1.379]

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.379

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS18 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Atu3271 glycosyltransferase (Agrobacterium fabrum C58)
MKTAIVHDWLTDRGGAEKVLHNLLEIYPHADLYCLVDFMSERDRGFLGGRPVNTSFIQKL
PFARKKYRSYLPFMPLAIEQFDLSGYDLVISSSYAVAKGVITGPGQFHVSYIHSPIRYAW
DLQHQYLKETRLNRGFASWIARAILHYIRMWDIRTTHGVDLMTVNSKFIRSRVRKCYGRD
STVIYPPVDTAHLSPSDRKGDYFVTASRLVPYKKVHLIVEAFAKMPDKRLVVIGDGPDMK
RIRDIATPNVEILGFVGNEELHKYMAEAKAFVFAAEDDFGIVPVESQALGTPVIAYGKGG
VLETVIPLGASNQPTGLYFGEQTPEAICAAVQEFVDNSDRFDKSACVDNAARFSRERFLR
EFADTVNFALAERA