Protein Info for Atu3268 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 88 to 111 (24 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 2 to 64 (63 residues), 40.9 bits, see alignment E=2.1e-14 PF00528: BPD_transp_1" amino acids 102 to 301 (200 residues), 152.1 bits, see alignment E=1.5e-48

Best Hits

Swiss-Prot: 39% identical to APPB_BACSU: Oligopeptide transport system permease protein AppB (appB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3268)

Predicted SEED Role

"Binding-protein-dependent transport systems inner membrane component precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS15 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Atu3268 dipeptide ABC transporter permease (Agrobacterium fabrum C58)
MIVVMFLVVTIVFVILRVTPGDPAAVMLGPDATAQDIAELRTRLGLDQSLGVQYVYYIGQ
LLKGDLGQSIFLNMPVGSALLDRAEPTFFLTIFSLLIAGVIALPIGIYAAYRRGSFVDQA
ATTIAMLAASIPSFWLGLILMQFFAVRLDLFPVSGYGGPGASFLERMYHLTLPAIALGLV
SSALILRFTRASMLDVLGDDYVRTARAKGVKERRVVMKHALKNALIPILTVLGLTAAVLI
SGAVVTETVFGLPGVGNLVVSAVLRRDYPVIQGALLVIAGLYVLINFAIDMLYLLVDPRV
RY