Protein Info for Atu3267 in Agrobacterium fabrum C58
Annotation: dipeptide ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to Y1093_BRUSU: Putative peptide transport system permease protein BRA1093/BS1330_II1085 (BRA1093) from Brucella suis biovar 1 (strain 1330)
KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3267)Predicted SEED Role
"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CEY2 at UniProt or InterPro
Protein Sequence (291 amino acids)
>Atu3267 dipeptide ABC transporter permease (Agrobacterium fabrum C58) MADITSTAPPTRNPTILFIRRLLKRRTVAAGLIVLLVFVLLAVFAPMIAPYSPSKLSIVN RLKPPSELYWFGTDEFGRDVFSRTIYAGRLSLLVGAAVVALSSIIGITLGLLAGFFQKLD TPIARLIDAMMAFPDILLAIALVAALGPSLTTVIIALAVVYSPRLARIVRASTLVIRELP YVEAARALGISTFHIMTRHVLRNLVSPILVQCTFLFASAMLAEAGLSFLGLGVSPEIPTW GTMISAGRQYIGQADWMTYFPGFAIILSVLSLQMVGDGLRDMLDPRLRRDL