Protein Info for Atu3267 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 90 to 116 (27 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 183 to 196 (14 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details PF12911: OppC_N" amino acids 17 to 65 (49 residues), 45.1 bits, see alignment 7.2e-16 PF00528: BPD_transp_1" amino acids 106 to 289 (184 residues), 106.2 bits, see alignment E=1.8e-34

Best Hits

Swiss-Prot: 49% identical to Y1093_BRUSU: Putative peptide transport system permease protein BRA1093/BS1330_II1085 (BRA1093) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu3267)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEY2 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Atu3267 dipeptide ABC transporter permease (Agrobacterium fabrum C58)
MADITSTAPPTRNPTILFIRRLLKRRTVAAGLIVLLVFVLLAVFAPMIAPYSPSKLSIVN
RLKPPSELYWFGTDEFGRDVFSRTIYAGRLSLLVGAAVVALSSIIGITLGLLAGFFQKLD
TPIARLIDAMMAFPDILLAIALVAALGPSLTTVIIALAVVYSPRLARIVRASTLVIRELP
YVEAARALGISTFHIMTRHVLRNLVSPILVQCTFLFASAMLAEAGLSFLGLGVSPEIPTW
GTMISAGRQYIGQADWMTYFPGFAIILSVLSLQMVGDGLRDMLDPRLRRDL