Protein Info for Atu3255 in Agrobacterium fabrum C58

Annotation: dicarboxylate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 6 to 17 (12 residues), see Phobius details transmembrane" amino acids 18 to 22 (5 residues), see Phobius details amino acids 24 to 25 (2 residues), see Phobius details amino acids 31 to 96 (66 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 133 to 134 (2 residues), see Phobius details amino acids 144 to 172 (29 residues), see Phobius details amino acids 183 to 231 (49 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details amino acids 294 to 325 (32 residues), see Phobius details amino acids 332 to 366 (35 residues), see Phobius details amino acids 375 to 401 (27 residues), see Phobius details amino acids 413 to 439 (27 residues), see Phobius details PF06808: DctM" amino acids 2 to 435 (434 residues), 414.3 bits, see alignment E=2.8e-128

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3255)

Predicted SEED Role

"TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CS03 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Atu3255 dicarboxylate ABC transporter permease (Agrobacterium fabrum C58)
MASASLLYIVFYNVAPDIIAAQRLIAGVESFPLLAVPFFILAGNLMNTAGVTGRIYSFAV
ALVGWMKGGLAQVNIIGSVIFSGMSGTALADAAGIGTIEIKAMKDHGYPVEAAVGVTAAS
ATLGPIFPPSLPFVIYGMMANVSIGALFMAGIVPGVVMTLLMMITVAVFAYIKGWGSDTP
FNLRTIFGASLEVLVVMMVPLGIYILTAFGLSLNLSILIVLVILLACDWYFDFSAVMALM
TPVILIGGMTMGWFTPTEAAVAAVLWSLFLGLVRYRTMTFKTLAKSTFDTIETTASVLFI
VAAASVFAWLLTVSQAAQLLSAAILTITDSKWIFLVLVNLLMLFVGCFLDTIAAITILVP
ILLPLVLQFNIDPVHFGLIITLNLMIGLLHPPLGMVLFVLSRVAKLSVERTTIAILPWLV
PLFVALLLITFIPAITLWLPTEMGLIR