Protein Info for Atu3248 in Agrobacterium fabrum C58
Annotation: cell division inhibitor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to MIND_NEIMB: Septum site-determining protein MinD (minD) from Neisseria meningitidis serogroup B (strain MC58)
KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 100% identity to atu:Atu3248)Predicted SEED Role
"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CEX2 at UniProt or InterPro
Protein Sequence (271 amino acids)
>Atu3248 cell division inhibitor (Agrobacterium fabrum C58) MGKVVVVTSGKGGVGKTTSTAALGAALAQNKEKVVVVDFDVGLRNLDLVMGAERRVVYDL VNVIQGDAKLTQALIRDKRLETLFLLPASQTRDKDNLTPEGVEWVIAELKKHFDWVICDS PAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLDSKTLKAERGERMEKHLLLTR YDSVRAERGDMLKVDDVLEILSIPLLGIIPESTDVLRASNVGAPVTLADARCAPAMAYFD AARRLSGEDIPVVIPGEKRGIFSKIFARRAA