Protein Info for Atu3248 in Agrobacterium fabrum C58

Annotation: cell division inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF13614: AAA_31" amino acids 2 to 150 (149 residues), 63.3 bits, see alignment E=1e-20 PF10609: ParA" amino acids 3 to 55 (53 residues), 39.2 bits, see alignment E=1.9e-13 TIGR01968: septum site-determining protein MinD" amino acids 3 to 266 (264 residues), 348.9 bits, see alignment E=8.5e-109 PF09140: MipZ" amino acids 4 to 169 (166 residues), 36.4 bits, see alignment E=1.3e-12 PF06564: CBP_BcsQ" amino acids 4 to 148 (145 residues), 42.7 bits, see alignment E=1.7e-14 PF02374: ArsA_ATPase" amino acids 5 to 40 (36 residues), 33.2 bits, see alignment 1.2e-11 PF01656: CbiA" amino acids 5 to 225 (221 residues), 68.7 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 60% identical to MIND_NEIMB: Septum site-determining protein MinD (minD) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 100% identity to atu:Atu3248)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEX2 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Atu3248 cell division inhibitor (Agrobacterium fabrum C58)
MGKVVVVTSGKGGVGKTTSTAALGAALAQNKEKVVVVDFDVGLRNLDLVMGAERRVVYDL
VNVIQGDAKLTQALIRDKRLETLFLLPASQTRDKDNLTPEGVEWVIAELKKHFDWVICDS
PAGIERGATLAMRHADVAVVVTNPEVSSVRDSDRIIGLLDSKTLKAERGERMEKHLLLTR
YDSVRAERGDMLKVDDVLEILSIPLLGIIPESTDVLRASNVGAPVTLADARCAPAMAYFD
AARRLSGEDIPVVIPGEKRGIFSKIFARRAA