Protein Info for Atu3239 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF01547: SBP_bac_1" amino acids 51 to 350 (300 residues), 123.8 bits, see alignment E=1.5e-39 PF13416: SBP_bac_8" amino acids 55 to 369 (315 residues), 101.6 bits, see alignment E=7.1e-33

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 100% identity to atu:Atu3239)

Predicted SEED Role

"Multiple sugar ABC transporter, substrate-binding protein" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEW7 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Atu3239 sugar ABC transporter substrate-binding protein (Agrobacterium fabrum C58)
MTIWHAGASLGGKLTGFATTTSIALMLGAASASAATVVKWMHVELDPKSVAVWEEIAKEY
EAKHPDVDVQLQFLENEAFKAKLPTLLQSNDVPDFFYSWGGGVLEEQSKTGALKDLTEVF
DADGGKLRQAYNASAIDGLSFDGKVWAVPYRVSLVSFFYNKELFAKAGVKAEDIKTWADF
STTVKKIKDAGIVPIAGGGGEKWPIHFYWSYLVMRNGGQPVFDAARKGEGEGFMDPAIIK
AGEQLAEFGKLEPFQPGYLGSTWPQALGVFGDGKAAIILGFDNTEANQRKNAGDGKGLAP
ENIGRFAFPVVEGGAGKATDTLGGLNGWALTKNASKEAIDFATFLTSKASEEKMATAGMI
LPVATGAAGAVKNPLLADSAKQLAASTWHQNFFDQTLGAAVGRVVNDVSVEIVSGQMTAE
EGAKQIQDAFELR