Protein Info for Atu3207 in Agrobacterium fabrum C58

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 227 to 394 (168 residues), 145.8 bits, see alignment E=5e-47 PF00990: GGDEF" amino acids 230 to 390 (161 residues), 152.4 bits, see alignment E=9.3e-49 PF00563: EAL" amino acids 413 to 641 (229 residues), 204.8 bits, see alignment E=1.3e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3207)

Predicted SEED Role

"Uncharacterized protein ylaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEV0 at UniProt or InterPro

Protein Sequence (664 amino acids)

>Atu3207 diguanylate cyclase (Agrobacterium fabrum C58)
MKHTLGEVSGQQDYRRPDSRFSDELLALYQQEGERSRRGSIRRGLWTAVFIYLLFAATDI
ILIPDVAFYTIFARFVVVLSSLLTLEIQLRKGASTAALDLTCATALVMGYIGWLVPSLFT
DNIENMSYYMVFGAIFMMGANLFFSFRFHLSLVSSGIILVTYFLASTQFPEDVFYKFAFG
TFYISCFVFTSYVNWNLNRERYHVFLNALEAKAQQKAADERGQALLRLSNTDSLTGLQNR
RAIDHHLRLLWDNWSKKGEGFAVLLIDVDFFKKYNDRYGHQEGDKCLMTVGNALQDAIID
HGASIGRYGGEEFIVLVPFKSKQQVGELAETIRHTVEELSLAHDQRRDGTFIVTVSIGAS
FTRPNPDGKLEKIINEADRALYIAKGNGRNCMKLFDPEDPQTSDETENIAALLKIAIAEN
LVSLVYQPILNVSTNETAGVEALMRLRLLDGNLVSPGIFIPIAERTGTIMELGLWTIKTV
CKQLLADDRVDVVSVNVSPMQLKNPGFATSVAAILVEAGIAGNRLAFEITEGVDMEMHSD
VLRCLSDLKTLGINIWLDDFGTGFAGLSWLRMTDFDTVKIDRSFLQDSNTPRGRAMLQDM
IRLIRNRGHNILIEGVETEDQLRLVRQMEIDYAQGYYIGRPVVAERLGAAATPYPRPNMR
MRPA