Protein Info for Atu3170 in Agrobacterium fabrum C58

Annotation: sorbitol/mannitol ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00005: ABC_tran" amino acids 22 to 161 (140 residues), 113.2 bits, see alignment E=2.2e-36 PF08402: TOBE_2" amino acids 256 to 325 (70 residues), 39.8 bits, see alignment E=6e-14 PF03459: TOBE" amino acids 271 to 323 (53 residues), 27.9 bits, see alignment 3.5e-10

Best Hits

Swiss-Prot: 74% identical to SMOK_RHOSH: ATP-binding transport protein SmoK (smoK) from Rhodobacter sphaeroides

KEGG orthology group: K10230, sorbitol/mannitol transport system ATP-binding protein (inferred from 100% identity to atu:Atu3170)

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CES9 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Atu3170 sorbitol/mannitol ABC transporter ATPase (Agrobacterium fabrum C58)
MGSISLQNVSKLFGEAKVIPSIDLDINDGEFVVFVGPSGCGKSTLLRLIAGLEDVSGGKI
VIDGNDATEKAPAERGLAMVFQSYALYPHMSVRNNIAFPLKMAKLDKAVIDKKVGDAARI
LNLTDYLERRPSQLSGGQRQRVAIGRAIVREPKAFLFDEPLSNLDAALRGTMRLEISELH
NTLKTTMIYVTHDQVEAMTMADKIVVLNRGNIEQVGSPMQLYRSPANLFVAGFIGSPRMN
LMTGDYARSKNATTAGVRPEHLTLSKETGLWQGKVTVAEHLGSDTFLHLEVSGIGPITAR
TDGEFECKHGDTVFITPDDTKIHRFDDKGIAI