Protein Info for Atu3169 in Agrobacterium fabrum C58

Annotation: sorbitol/mannitol ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 182 to 207 (26 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 256 (169 residues), 53.4 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to atu:Atu4449)

MetaCyc: 63% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CES8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu3169 sorbitol/mannitol ABC transporter permease (Agrobacterium fabrum C58)
MARKTTTRAKIGFSIAAWAVALLLFFPILYAFLTSIKTEPEAIAGFSLLPSGTLENYITV
QTQRDYFKPFMNSVVLSLGSTIIALIIAIPAAWAMAFSPTKRTKDILMWMLSTKMMPGVA
VLVPIYLIFRNAGLLDTRIGLTVMLTFINLPIVVWMLYTYFREIPGEILEAARMDGASLW
NEIVHVLTPMAVPGIASTLLLNVILAWNESFWTIRLTTTNAAPLTAFIASFSSPQGLFWA
KLSAASMMAIAPILVIGWFSQKQLVRGLTFGAVK