Protein Info for Atu3166 in Agrobacterium fabrum C58

Annotation: fructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 143 to 162 (20 residues), see Phobius details PF00294: PfkB" amino acids 55 to 308 (254 residues), 131.2 bits, see alignment E=2.7e-42

Best Hits

Swiss-Prot: 100% identical to TAGK_AGRFC: Tagatose kinase (Atu3166) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00924, [EC: 2.7.1.-] (inferred from 100% identity to atu:Atu3166)

MetaCyc: 100% identical to tagatose kinase (Agrobacterium fabrum C58)
Tagatose kinase. [EC: 2.7.1.101]

Predicted SEED Role

"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.4

Use Curated BLAST to search for 2.7.1.- or 2.7.1.101 or 2.7.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CES5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Atu3166 fructokinase (Agrobacterium fabrum C58)
MRQASVLAPHTNGPTVTAGEILVEIMATTVGDGFLEPQTLIGPFPSGAPAIFIDQVARCG
GTAGIIAAVGDDDFGRLNIERLRRDGVDVSAITTIADRPTGSAFVRYRENGARDFVFNIA
HSAASETRMTDEAQALIEKAGHVHIMGSAFAIAGIGAIILEAVKSVKARGGSVSFDPNIR
KELAQGDEGRRLIDDLLAVTDLLLPSGEELQAASGLDDEEAAIEKLLAAGIGEIVLKRGA
NGASHFSRAHGRIDAPGLEVEEIDPTGAGDCFGATYLTCRRLGMRPGKALVYANASGAHN
VTKRGPMEGAASLAELDAFMAAQLSEEVL