Protein Info for Atu3166 in Agrobacterium fabrum C58
Annotation: fructokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to TAGK_AGRFC: Tagatose kinase (Atu3166) from Agrobacterium fabrum (strain C58 / ATCC 33970)
KEGG orthology group: K00924, [EC: 2.7.1.-] (inferred from 100% identity to atu:Atu3166)MetaCyc: 100% identical to tagatose kinase (Agrobacterium fabrum C58)
Tagatose kinase. [EC: 2.7.1.101]
Predicted SEED Role
"Fructokinase (EC 2.7.1.4)" in subsystem Fructose utilization or Mannitol Utilization or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization or Sucrose utilization or Sucrose utilization Shewanella (EC 2.7.1.4)
MetaCyc Pathways
- D-altritol and galactitol degradation (4/4 steps found)
- sucrose degradation III (sucrose invertase) (4/4 steps found)
- sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
- D-sorbitol degradation I (3/3 steps found)
- mannitol cycle (4/5 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- superpathway of anaerobic sucrose degradation (13/19 steps found)
- sucrose degradation VII (sucrose 3-dehydrogenase) (2/4 steps found)
- heterolactic fermentation (12/18 steps found)
- sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
KEGG Metabolic Maps
- Fructose and mannose metabolism
- Galactose metabolism
- Lipopolysaccharide biosynthesis
- Nicotinate and nicotinamide metabolism
- Nucleotide sugars metabolism
- Pentose phosphate pathway
- Starch and sucrose metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.1.4
Use Curated BLAST to search for 2.7.1.- or 2.7.1.101 or 2.7.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CES5 at UniProt or InterPro
Protein Sequence (329 amino acids)
>Atu3166 fructokinase (Agrobacterium fabrum C58) MRQASVLAPHTNGPTVTAGEILVEIMATTVGDGFLEPQTLIGPFPSGAPAIFIDQVARCG GTAGIIAAVGDDDFGRLNIERLRRDGVDVSAITTIADRPTGSAFVRYRENGARDFVFNIA HSAASETRMTDEAQALIEKAGHVHIMGSAFAIAGIGAIILEAVKSVKARGGSVSFDPNIR KELAQGDEGRRLIDDLLAVTDLLLPSGEELQAASGLDDEEAAIEKLLAAGIGEIVLKRGA NGASHFSRAHGRIDAPGLEVEEIDPTGAGDCFGATYLTCRRLGMRPGKALVYANASGAHN VTKRGPMEGAASLAELDAFMAAQLSEEVL