Protein Info for Atu3161 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 60 to 184 (125 residues), 24.6 bits, E=5.3e-09
• PF21135: DRL_cat
  • amino acids 192 to 375 (184 residues), 192 bits, E=1.1e-60
• PF08666: SAF
  • amino acids 398 to 463 (66 residues), 23.1 bits, E=1.4e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3161)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-homoserine biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A9CES2 at UniProt or InterPro

Protein Sequence (489 amino acids)

>Atu3161 hypothetical protein (Agrobacterium fabrum C58)
MWPAPRRVNLRSLGIAWPSPGGLDTLASNFPSEGCQNMNLYSLLSARAAGGKPVRVGLIG
AGKFGSMVLAQAQRIAGFHMVAVADLNVGKARESFDRVGWPKERYDATSCADALKSGKTY
VTDDVNELFACGEIECIIEATGHPLAGARHALGAIDHNKHVVMVNVEADVMVGPILAEKA
RAKGLIYSMAYGDQPALICELVDWARATGFEVVSAGKGMNFEPRYRYSTPDTVWSYFGWT
DEEVAKGDFNPKMYNSFTDGTKAAIEMAAVANGTGLDCPDDGLAFPPAGLHDLARVFRPA
ADGGRMSRSGLVDIAASQEPDGREVFNNIRYGVFVTFKAHNDYARACFKQYGLLTDPSGW
YASMWRPFHIIGLETSISVLSAVLRNEPTGCSKEFRGDAVATAKKDMQPGEMLDGEGGYA
VWANAIPATRSLDIKALPIGLAHNVKLKRPIKKDQIVSFDDVELVSDLDVVKLRQDMEHQ
FRPQKDAAA