Protein Info for Atu3154 in Agrobacterium fabrum C58

Annotation: fosmidomycin resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 342 to 366 (25 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 358 (336 residues), 122.1 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 55% identical to FSR_ECOLI: Fosmidomycin resistance protein (fsr) from Escherichia coli (strain K12)

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 100% identity to atu:Atu3154)

MetaCyc: 55% identical to fosmidomycin efflux pump (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-41

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CER7 at UniProt or InterPro

Protein Sequence (398 amino acids)

>Atu3154 fosmidomycin resistance protein (Agrobacterium fabrum C58)
MATVTSAGFNPQRTAFSIIAAASFCHMLNDIMQSLLTSLYPLLKANYALDFMQIGLLTFA
FQVTASLLQPVVGMVTDRWPMPFSLPVAMLSTCAGLITLAFAHSFEVLVIGACLIGVGSA
IFHPEASRVARLASGGRHGLAQSFFQVGGNTGTAIGPLLAAFIVIPLGQSSLSWFSLIAL
VGFGVLSWVGVWYTRHRRANVGKAPASRTLPLARGTVMMTLLVLVVLTATKNAYLASLSS
YFTFYTIDKFGLGVQDAQVLLFLFLGASALGVFFGGPIGDRFGSRVVIWFSILGVIPFAL
MLPYANLFWTAILVVVIGFVFSSAFSAIVVFAQELVPGRVGLIAGMFFGFAFGFGGIGAA
VLGVYADREGIEFVYRICSYMPLLGLLTVFLPKLPSHR