Protein Info for Atu3150 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 200 to 224 (25 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 69 to 279 (211 residues), 50.6 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 40% identical to LACF_RHIRD: Lactose transport system permease protein LacF (lacF) from Rhizobium radiobacter

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 100% identity to atu:Atu3150)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRQ7 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Atu3150 sugar ABC transporter permease (Agrobacterium fabrum C58)
MPSRNRIAYAFLAPYLLIFATFWVWPIISSFMLSFQNTRINPWRFAPSMNWGRLVSDPAF
YNALYNTLIILVIQVPVMIALATVMAVLLNSPLLKVRPLYRFAFFAPVVVGEVAYAAVFR
LMFSADFGIINKLITSVGLSPISWFDNANAAMALVIIAVTWRWAGYNAIIILAGLQSIPG
DVYEAATLDKVSKRQQFFHITLPLLKPIILFCVVLSVIGTMQLFAEPFLITNRGGPGGGT
ETLGLFLYRQGFTSLNFGYASAIAYTMAALAIAISLLNLWVGREPK