Protein Info for Atu3138 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GLI_AGRFC: D-galactarolactone isomerase (Atu3138) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K07046, (no description) (inferred from 100% identity to atu:Atu3138)

MetaCyc: 100% identical to D-galactarolactone isomerase (Agrobacterium fabrum C58)
RXN-15901 [EC: 5.4.1.4]

Predicted SEED Role

"Amidohydrolase 2"

MetaCyc Pathways

D-galacturonate degradation II (5/5 steps found)
D-glucuronate degradation II (5/5 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (22/31 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEQ7 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Atu3138 hypothetical protein (Agrobacterium fabrum C58)
MSELVRKLSGTAPNPAFPRGAVDTQMHMYLPGYPALPGGPGLPPGALPGPEDYRRLMQWL
GIDRVIITQGNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIM
DLPGGAVNLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKG
IRTDGPEMAALLKLIDRGNLWFKFAGVYESSRKSWPYADVAAFSRVIAAHAPERIVWGTN
WPHNSVRETAAYPDDARLAELTLGWLPDEAARHRALVENPEALFKLSPVKAT