Protein Info for Atu3112 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 196 to 220 (25 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 280 (171 residues), 63.1 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 46% identical to YESQ_BACSU: Probable ABC transporter permease protein YesQ (yesQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3112)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CEP6 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Atu3112 sugar ABC transporter permease (Agrobacterium fabrum C58)
MTDAVTAPRPGQGPQRSPLKSVMLHTALIIASFAMLYPILWMISGSFRPQDELFGSSSLI
PSAVDVGGYIRGWTGLQVSFGQFFWNSFFISVLATIGNVVGCSLTAFAFARLRFGGRNFW
FALMLGTLMLPYHVVLIPQYILFLEMGWVNTSLPLIVPKYLATDAFFIFLMVQFFRGIPR
ELDEAAVMDGCSPFRIYWKIMLPLSMPVLATAAIFSFIWTWDDFFGPLIYLNDINTYTVQ
LGLRSFVDSTGSSDWTSLFAMSNLSLVPVFLFFLFFQRLLIEGIATTGMKR