Protein Info for Atu3089 in Agrobacterium fabrum C58

Annotation: spermidine/putrescine ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF00005: ABC_tran" amino acids 23 to 164 (142 residues), 107.9 bits, see alignment E=6.4e-35 PF08402: TOBE_2" amino acids 279 to 356 (78 residues), 50 bits, see alignment E=2.8e-17

Best Hits

Swiss-Prot: 44% identical to POTA_RUEPO: Spermidine/putrescine import ATP-binding protein PotA (potA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to atu:Atu3089)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRK3 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Atu3089 spermidine/putrescine ABC transporter ATPase (Agrobacterium fabrum C58)
MSKAAAIDIASVSKIYGTTTAVHAISLKIPAGSYCCLLGPSGCGKTSTLRMIAGHESISS
GDIRLGNMVVTDLPPARRGTAMMFQSYALFPHLDLVDNVAFSLKMKGADKETRRAKALEM
LQLMQLEPYANRRPAQLSGGQQQRVALARALITDPEALLLDEPLSALDPFLKIRMRAELK
KLQTLLGITFVHVTHSQEEAMALADIVVVMNDGRIEQAATPREVFERPATAFVARFMGDH
NVISGRYREKSGDLVTLEVAGGGTFVASGMAPDDGAVDIAVRTDRVRVGEAEQPGLGFTG
IVSNVEYRGASVKIAVTGAGIEDFNVILSDAAFFENPVRTGDAIPLSWNAADAIVLGRVE
K