Protein Info for Atu3087 in Agrobacterium fabrum C58

Annotation: spermidine/putrescine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 298 (197 residues), 31.7 bits, see alignment E=6.5e-12

Best Hits

Swiss-Prot: 31% identical to POTB_SALTI: Spermidine/putrescine transport system permease protein PotB (potB) from Salmonella typhi

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to atu:Atu3087)

MetaCyc: 31% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"ABC transporter permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CRK1 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Atu3087 spermidine/putrescine ABC transporter permease (Agrobacterium fabrum C58)
MVTVRLIGVSEKKEKLSRSFALPQKLVSYIQATPLFLILGFFLALPILMIAVVSFWDYDF
AQMYPDFVTFNYLETLGSWVIWQTYLNTLKYAAIVWAITLFCGFWVAYFLAFHIRTTTMQ
MVLFLVCTVPFLTSNIIRMISWIPVLGRNGLVNSALVGTGILPEPVEWLLYSDFAVVLAM
VHLYTLFMVTPIFNTLMRIDKSLIEAARDAGATGWQTLSNVIIPLAKPGMAIGSIFVVTL
VMADFSTVQVMSGGQSASVALMMKNQMSLLQYPAAAANAVILLILVLLMVAGILRIVDIR
KEL